AGI ID: At1g01780

TF ID:TF_73
Super family:LIM-domain
Sub family:
Gene name: LIM domain protein, putative

Amino Acid Sequence:


1
61
121
181
>At1g01780
MSFTGTLDKC NVCDKTVYVV DMLSIEGMPY HKSCFRCTHC KGTLQMSNYS SMDGVLYCKT
HFEQLFKESG NFSKNFQPGK TEKPELTRTP SKISSIFCGT QDKCAACEKT VYPLEKIQME
GECFHKTCFR CAHGGCTLTH SSYASLDSVL YCRHHFNQLF MEKGNYAHVL QAANHRRTAS
GNTLPPEPTE DVAVEAKEEN GVSES
Length = 205 AA.

PSI BLAST Result:

Query: Query sequence of TF_73
Sbjct: At1g01780

>At1g01780 LIM domain protein, putative
          Length = 205

 Score =  224 bits (571), Expect = 1e-59
 Identities = 73/124 (58%), Positives = 99/124 (78%), Gaps = 4/124 (3%)

Query: 1   MEGVLYCKPHFEQLFKESGSFNKNFQSPAKSADKSTPELTRTPSRVAGRFSGTQEKCATC 60
           M+GVLYCK HFEQLFKESG+F+KNFQ          PELTRTPS+++  F GTQ+KCA C
Sbjct: 52  MDGVLYCKTHFEQLFKESGNFSKNFQ----PGKTEKPELTRTPSKISSIFCGTQDKCAAC 107

Query: 61  SKTVYPIEKVTVESQTYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSYN 120
            KTVYP+EK+ +E + +HK+CF+C+HGGC ++ S+YA+L+ +LYC+HHF QLF EKG+Y 
Sbjct: 108 EKTVYPLEKIQMEGECFHKTCFRCAHGGCTLTHSSYASLDSVLYCRHHFNQLFMEKGNYA 167

Query: 121 HLIK 124
           H+++
Sbjct: 168 HVLQ 171



 Score = 99.2 bits (246), Expect = 7e-22
 Identities = 35/75 (46%), Positives = 54/75 (71%)

Query: 50  FSGTQEKCATCSKTVYPIEKVTVESQTYHKSCFKCSHGGCPISPSNYAALEGILYCKHHF 109
           F+GT +KC  C KTVY ++ +++E   YHKSCF+C+H    +  SNY++++G+LYCK HF
Sbjct: 3   FTGTLDKCNVCDKTVYVVDMLSIEGMPYHKSCFRCTHCKGTLQMSNYSSMDGVLYCKTHF 62

Query: 110 AQLFKEKGSYNHLIK 124
            QLFKE G+++   +
Sbjct: 63  EQLFKESGNFSKNFQ 77


InterPro Results:

IPR001781 Domain
PD000094 T[9-65] 1e-29T[103-156] 1e-28 sp_Q9LQ78_ARATH_Q9LQ78;
PF00412 T[10-67] 3.2e-14T[104-161] 1.4e-14 LIM
SM00132 T[9-61] 5.7e-12T[103-155] 3.2e-11 LIM
PS50023 T[8-68] 13.296T[102-162] 12.157 LIM_DOMAIN_2
PS00478 T[10-44] 8e-5 LIM_DOMAIN_1
Zn-binding protein, LIM
NULL
SSF57716 T[1-35] 4.3e-08T[36-79] 2.1e-12T[87-129] 9.4e-10T[130-168] 6.8e-09 Glucocorticoid receptor-like (DNA-binding domain)
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
Microarray expression data
Genome Map
Alternative splicing: Yes

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_73 LIM-domain224 1e-59

TOP