AGI ID: At2g45800

TF ID:TF_73
Super family:LIM-domain
Sub family:
Gene name: LIM-domain like protein

Amino Acid Sequence:


1
61
121
181
>At2g45800
MSFTGTLDKC KACDKTVYVM DLLTLEGNTY HKSCFRCTHC KGTLVISNYS SMDGVLYCKP
HFEQLFKESG NYSKNFQAGK TEKPNDHLTR TPSKLSSFFS GTQDKCATCK KTVYPLEKVT
MEGESYHKTC FRCTHSGCPL THSSYASLNG VLYCKVHFNQ LFLEKGSYNH VHQAAANHRR
SASSGGASPP SDDHKPDDTA SIPEAKEDDA APEAAGEEEP EPVVES
Length = 226 AA.

PSI BLAST Result:

Query: Query sequence of TF_73
Sbjct: At2g45800

>At2g45800 LIM-domain like protein
          Length = 226

 Score =  226 bits (576), Expect = 4e-60
 Identities = 81/124 (65%), Positives = 104/124 (83%), Gaps = 2/124 (1%)

Query: 1   MEGVLYCKPHFEQLFKESGSFNKNFQSPAKSADKSTPELTRTPSRVAGRFSGTQEKCATC 60
           M+GVLYCKPHFEQLFKESG+++KNFQ  A   +K    LTRTPS+++  FSGTQ+KCATC
Sbjct: 52  MDGVLYCKPHFEQLFKESGNYSKNFQ--AGKTEKPNDHLTRTPSKLSSFFSGTQDKCATC 109

Query: 61  SKTVYPIEKVTVESQTYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSYN 120
            KTVYP+EKVT+E ++YHK+CF+C+H GCP++ S+YA+L G+LYCK HF QLF EKGSYN
Sbjct: 110 KKTVYPLEKVTMEGESYHKTCFRCTHSGCPLTHSSYASLNGVLYCKVHFNQLFLEKGSYN 169

Query: 121 HLIK 124
           H+ +
Sbjct: 170 HVHQ 173



 Score =  102 bits (255), Expect = 7e-23
 Identities = 38/75 (50%), Positives = 55/75 (72%)

Query: 50  FSGTQEKCATCSKTVYPIEKVTVESQTYHKSCFKCSHGGCPISPSNYAALEGILYCKHHF 109
           F+GT +KC  C KTVY ++ +T+E  TYHKSCF+C+H    +  SNY++++G+LYCK HF
Sbjct: 3   FTGTLDKCKACDKTVYVMDLLTLEGNTYHKSCFRCTHCKGTLVISNYSSMDGVLYCKPHF 62

Query: 110 AQLFKEKGSYNHLIK 124
            QLFKE G+Y+   +
Sbjct: 63  EQLFKESGNYSKNFQ 77


InterPro Results:

IPR001781 Domain
PD000094 T[9-65] 2e-29T[105-158] 5e-28 sp_O80839_ARATH_O80839;
PF00412 T[10-67] 1.8e-14T[106-163] 3.1e-14 LIM
SM00132 T[9-61] 4.7e-11T[105-157] 7.9e-13 LIM
PS50023 T[8-68] 13.424T[104-164] 12.514 LIM_DOMAIN_2
PS00478 T[10-44] 8e-5 LIM_DOMAIN_1
Zn-binding protein, LIM
NULL
seg ?[174-194]?[203-225] seg
SSF57716 T[1-35] 3.1e-08T[36-94] 2e-12T[95-131] 3e-10T[132-170] 3.1e-08 Glucocorticoid receptor-like (DNA-binding domain)
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_73 LIM-domain226 4e-60

TOP