AGI ID: At3g55770

TF ID:TF_73
Super family:LIM-domain
Sub family:
Gene name: transcription factor L2

Amino Acid Sequence:


1
61
121
181
>At3g55770
MSFTGTQQKC KACEKTVYAV ELLSADGVGY HKSCFKCTHC KSRLQLSSYS SMEGVLYCKP
HFEQLFKESG SFNKNFQSPA KSADKSTPEL TRTPSRVAGR FSGTQEKCAT CSKTVYPIEK
VTVESQTYHK SCFKCSHGGC PISPSNYAAL EGILYCKHHF AQLFKEKGSY NHLIKSASIK
RSAAAAVAAG VPAASVPES
Length = 199 AA.

PSI BLAST Result:

Query: Query sequence of TF_73
Sbjct: At3g55770

>At3g55770 transcription factor L2
          Length = 199

 Score =  231 bits (589), Expect = 1e-61
 Identities = 124/124 (100%), Positives = 124/124 (100%)

Query: 1   MEGVLYCKPHFEQLFKESGSFNKNFQSPAKSADKSTPELTRTPSRVAGRFSGTQEKCATC 60
           MEGVLYCKPHFEQLFKESGSFNKNFQSPAKSADKSTPELTRTPSRVAGRFSGTQEKCATC
Sbjct: 52  MEGVLYCKPHFEQLFKESGSFNKNFQSPAKSADKSTPELTRTPSRVAGRFSGTQEKCATC 111

Query: 61  SKTVYPIEKVTVESQTYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSYN 120
           SKTVYPIEKVTVESQTYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSYN
Sbjct: 112 SKTVYPIEKVTVESQTYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSYN 171

Query: 121 HLIK 124
           HLIK
Sbjct: 172 HLIK 175



 Score = 95.3 bits (236), Expect = 9e-21
 Identities = 39/75 (52%), Positives = 54/75 (72%)

Query: 50  FSGTQEKCATCSKTVYPIEKVTVESQTYHKSCFKCSHGGCPISPSNYAALEGILYCKHHF 109
           F+GTQ+KC  C KTVY +E ++ +   YHKSCFKC+H    +  S+Y+++EG+LYCK HF
Sbjct: 3   FTGTQQKCKACEKTVYAVELLSADGVGYHKSCFKCTHCKSRLQLSSYSSMEGVLYCKPHF 62

Query: 110 AQLFKEKGSYNHLIK 124
            QLFKE GS+N   +
Sbjct: 63  EQLFKESGSFNKNFQ 77


InterPro Results:

IPR001781 Domain
PD000094 T[9-65] 1e-28T[107-163] 1e-29 sp_Q9M047_ARATH_Q9M047;
PF00412 T[10-67] 1.5e-15T[108-165] 2.4e-18 LIM
SM00132 T[9-61] 5.4e-13T[107-159] 1.2e-13 LIM
PS50023 T[8-68] 13.751T[106-166] 12.573 LIM_DOMAIN_2
PS00478 T[10-44] 8e-5 LIM_DOMAIN_1
Zn-binding protein, LIM
NULL
seg ?[176-196] seg
SSF57716 T[1-35] 6.3e-08T[36-78] 1.2e-11T[91-133] 3.2e-09T[134-172] 1.2e-10 Glucocorticoid receptor-like (DNA-binding domain)
NULL

Selected Motif:

Link to RARGE contents:

Riken Full-Length cDNA clone
Genome Map
Alternative splicing: Yes

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_73 LIM-domain231 1e-61

TOP