AGI ID: At3g61230

TF ID:TF_73
Super family:LIM-domain
Sub family:
Gene name: LIM domain protein

Amino Acid Sequence:


1
61
121
181
>At3g61230
MAAFTGTTDK CKACDKTVYV MDLMTLEGMP YHKSCFRCSH CNGTLVICNY SSMDGVLYCK
THFEQLFKES GNFSKNFQTA GKTEKSNDAA PNRLSSFFSG TQDKCAACKK TVYPLEKMTM
EGESYHKTCF RCAHSGCPLT HSSYAALDGV LYCKVHFSQL FLEKGNYNHV LQAAANHRRS
TAEEDKTEPK EDEANPTEEE TSDAAAEEHE S
Length = 211 AA.

PSI BLAST Result:

Query: Query sequence of TF_73
Sbjct: At3g61230

>At3g61230 LIM domain protein
          Length = 211

 Score =  223 bits (568), Expect = 4e-59
 Identities = 74/124 (59%), Positives = 102/124 (81%), Gaps = 4/124 (3%)

Query: 1   MEGVLYCKPHFEQLFKESGSFNKNFQSPAKSADKSTPELTRTPSRVAGRFSGTQEKCATC 60
           M+GVLYCK HFEQLFKESG+F+KNFQ+  K+   +       P+R++  FSGTQ+KCA C
Sbjct: 53  MDGVLYCKTHFEQLFKESGNFSKNFQTAGKTEKSNDA----APNRLSSFFSGTQDKCAAC 108

Query: 61  SKTVYPIEKVTVESQTYHKSCFKCSHGGCPISPSNYAALEGILYCKHHFAQLFKEKGSYN 120
            KTVYP+EK+T+E ++YHK+CF+C+H GCP++ S+YAAL+G+LYCK HF+QLF EKG+YN
Sbjct: 109 KKTVYPLEKMTMEGESYHKTCFRCAHSGCPLTHSSYAALDGVLYCKVHFSQLFLEKGNYN 168

Query: 121 HLIK 124
           H+++
Sbjct: 169 HVLQ 172



 Score =   99 bits (248), Expect = 5e-22
 Identities = 36/75 (48%), Positives = 53/75 (70%)

Query: 50  FSGTQEKCATCSKTVYPIEKVTVESQTYHKSCFKCSHGGCPISPSNYAALEGILYCKHHF 109
           F+GT +KC  C KTVY ++ +T+E   YHKSCF+CSH    +   NY++++G+LYCK HF
Sbjct: 4   FTGTTDKCKACDKTVYVMDLMTLEGMPYHKSCFRCSHCNGTLVICNYSSMDGVLYCKTHF 63

Query: 110 AQLFKEKGSYNHLIK 124
            QLFKE G+++   +
Sbjct: 64  EQLFKESGNFSKNFQ 78



 Score = 41.8 bits (97), Expect = 1e-04
 Identities = 20/45 (44%), Positives = 28/45 (61%), Gaps = 1/45 (2%)

Query: 1   MEGVLYCKPHFEQLFKESGSFNKNFQSPAKSADKSTPELTRTPSR 45
           ++GVLYCK HF QLF E G++N   Q+ A    +ST E  +T  +
Sbjct: 147 LDGVLYCKVHFSQLFLEKGNYNHVLQAAAN-HRRSTAEEDKTEPK 190


InterPro Results:

IPR001781 Domain
PD000094 T[10-66] 4e-30T[104-157] 6e-28 sp_Q9M2E1_ARATH_Q9M2E1;
PF00412 T[11-68] 3.3e-11T[105-162] 4.9e-15 LIM
SM00132 T[10-62] 2.3e-10T[104-156] 6.7e-14 LIM
PS50023 T[9-69] 13.137T[103-163] 12.702 LIM_DOMAIN_2
PS00478 T[11-45] 8e-5 LIM_DOMAIN_1
Zn-binding protein, LIM
NULL
seg ?[197-211] seg
SSF57716 T[2-36] 5.2e-08T[37-94] 8.6e-13T[95-130] 7.7e-10T[131-169] 1.6e-08 Glucocorticoid receptor-like (DNA-binding domain)
NULL

Selected Motif:

Link to RARGE contents:

Genome Map

Gene information on other websites:

TIGR
TAIR
MIPS

Belonging families:

TF IDSuper familySub familyScoreE value
TF_73 LIM-domain223 4e-59

TOP